DPCfam | MC111710
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Residues in low-complexity regions (%) | 0.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00141 |
| Sequences matching dominant architecture (%) | 78.43 |
| Average overlap percent | 12.18 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1N7LQ06 | 680-737 | 58 | KTGEVRWSASRVDLIFGSNSQLRAISEVYAQEDAKEKFVKDFVKAWDKVMNLDRFDLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B2V515-F1 | 671-729 | 98.33 | 97.68 | View in AlphaFoldDB ↗ |