DPCfam | MC111206
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Residues in low-complexity regions (%) | 5.17 |
| Residues in coiled-coil regions (%) | 6.59 |
| Predicted disordered residues (%) | 41.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04703 |
| Sequences matching dominant architecture (%) | 3.9 |
| Average overlap percent | 32.21 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M0A565 | 20-156 | 137 | SVESRIYRSIAKTEGKITPSEISDFANCDLQLTREYLRSFTSLGVVIKHTDAPPTYERNDAHFEWEAVKALAQQNRLNEIEDRIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B0R4X4-F1 | 3-51 | 33.56 | 96.16 | View in AlphaFoldDB ↗ |