DPCfam | MC11104
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 207 ± 21 aa |
| Residues in low-complexity regions (%) | 7.79 |
| Residues in coiled-coil regions (%) | 1.44 |
| Predicted disordered residues (%) | 1.46 |
| Average transmembrane regions | 5.16 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3DIV1 | 27-235 | 209 | MKSVKDGFTYGEASIVTQTFLLFQMHVYTNAFLSKQGLVNCQDIATLVLQVGLSCIVLHGSLVYIVPSLRSPLTFYPCLALIATL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZLM6-F1 | 181-376 | 98.98 | 92.31 | View in AlphaFoldDB ↗ |