DPCfam | MC110924
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Residues in low-complexity regions (%) | 1.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04053 |
| Sequences matching dominant architecture (%) | 98.86 |
| Average overlap percent | 33.16 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3KB74 | 513-629 | 117 | AFEVLGEVQEVVKTGVWVGDCFIYTSSVNRLSYYVGGEIITIAHMDRTMYLLGYIPKDDRLYLGDKELNVISYSLLLSVLEYQTA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2K0P9-F1 | 506-644 | 100.00 | 90.99 | View in AlphaFoldDB ↗ |