DPCfam | MC110842
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 561 ± 105 aa |
| Residues in low-complexity regions (%) | 2.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.62 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF01612 |
| Sequences matching dominant architecture (%) | 47.83 |
| Average overlap percent | 35.44 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A1MMQ3 | 318-740 | 423 | VRKLIKYGYFNEAITAIKKLDLFPRFDIPAIATDLFTSGQGMLLPTLVSQRPILQRELLDFIDKQLRFSFAGSLGIVAPERLSNV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QSS0-F1 | 90-676 | 98.44 | 85.24 | View in AlphaFoldDB ↗ |