DPCfam | MC11068
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 207 ± 28 aa |
| Residues in low-complexity regions (%) | 1.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.12 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01425 |
| Sequences matching dominant architecture (%) | 93.33 |
| Average overlap percent | 15.88 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J9QQA8 | 120-309 | 190 | DQHRLSAHWIAEQTRAYQACDTFQHAFLHGIVLTTSNAEPAKIGEQAKMVLRKTGVKWISWLTRSKDSRLTFRPGPHYTNGACFY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VS33-F1 | 68-262 | 95.31 | 90.20 | View in AlphaFoldDB ↗ |