DPCfam | MC110599
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 364 ± 57 aa |
| Residues in low-complexity regions (%) | 2.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00637- PF00637- PF00637 |
| Sequences matching dominant architecture (%) | 67.01 |
| Average overlap percent | 76.21 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8FH54 | 67-472 | 406 | NRLKLLLPWLENRVHEGSEEPATHNALAKIYIDANNNPERFLRENRFYDSRVIGKYTEKRDPHLSCLAYERGQCDEDLIRVCNEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A286YAZ4-F1 | 885-1283 | 100.00 | 72.29 | View in AlphaFoldDB ↗ |