DPCfam | MC110496
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 62 ± 9 aa |
| Residues in low-complexity regions (%) | 3.6 |
| Residues in coiled-coil regions (%) | 14.28 |
| Predicted disordered residues (%) | 31.58 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01926 |
| Sequences matching dominant architecture (%) | 82.94 |
| Average overlap percent | 7.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4MGL2 | 98-161 | 64 | AFDNPAVPHPAGSVDAVRDYRQLNSELLLADLGVVERRVERLSKDLRKMKDPELAHEHDMLLRC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4J410-F1 | 128-191 | 100.00 | 93.19 | View in AlphaFoldDB ↗ |