DPCfam | MC110306
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Residues in low-complexity regions (%) | 1.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03417 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 37.92 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A124GSJ9 | 1-71 | 71 | MVTEAGIVGKIGFNTNGVGTCLNAIRAKPMISSKVPIHVALRLCLESTSVDNAVKTLESLGGVASAQHILC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2FI43-F1 | 75-157 | 97.65 | 97.38 | View in AlphaFoldDB ↗ |