DPCfam | MC110198
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 246 ± 46 aa |
| Residues in low-complexity regions (%) | 6.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.37 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F7SJB1 | 38-244 | 207 | LAVERYYELDAVYENPILSFYSKPSITDAFLLSRFVSSFRGPALSVLYPTTWARGTINMIKSIWGSQENKNSQSEHGWKVVSVWS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9FMC7-F1 | 123-161 | 14.88 | 89.48 | View in AlphaFoldDB ↗ |