DPCfam | MC110064
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 128 ± 18 aa |
| Residues in low-complexity regions (%) | 8.92 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 4.7 |
| Average transmembrane regions | 0.91 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00077E8622 | 95-241 | 147 | FHGAKTPCLESEDENYVVYLTTFAHYLSGNENNTELYQNLLCSKHISELSSLISCRNHGKLADGRGMCEDCLFSFTTKNKANAEM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JRQ3-F1 | 17-158 | 96.95 | 64.74 | View in AlphaFoldDB ↗ |