DPCfam | MC109659
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 387 ± 54 aa |
| Residues in low-complexity regions (%) | 2.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.46 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF01545 |
| Sequences matching dominant architecture (%) | 0.78 |
| Average overlap percent | 5.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M3QWJ5 | 1264-1559 | 296 | FERMKFLIDESSLQNYAKLETFNESRSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QBU6-F1 | 535-939 | 100.00 | 88.10 | View in AlphaFoldDB ↗ |