DPCfam | MC109535
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 562 ± 107 aa |
| Residues in low-complexity regions (%) | 14.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.14 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N1JDA7 | 43-567 | 525 | GGIGAAISRPKLVSQSSFDPSQELPTVSFEVKTTSPQRPLRQSYVAPTLDPTNFQELTPSIQKPLQSWISEKAELVSPSINSLDM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PXQ9-F1 | 231-946 | 99.51 | 58.29 | View in AlphaFoldDB ↗ |