DPCfam | MC109475
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02358 |
| Sequences matching dominant architecture (%) | 96.72 |
| Average overlap percent | 29.42 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F4I1A6 | 188-249 | 62 | LTVHFRRVDETGWAALAEQVRLVLIDYPKLRLTQGRKVLELRPSIKWDKGKALEFLLNSLGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LNL8-F1 | 231-289 | 100.00 | 95.10 | View in AlphaFoldDB ↗ |