DPCfam | MC109203
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Residues in low-complexity regions (%) | 3.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09414 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 46.69 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0002B4CCF0 | 23-110 | 88 | EKTSWIVLEKIHGANFSFHTDGEWVQIGRRRDFLMEGENFFNHITASFMNDYPEKMKTIYRMVETSTGKQIKQVSIYGELFGGYY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DGX0-F1 | 27-146 | 95.28 | 95.56 | View in AlphaFoldDB ↗ |