DPCfam | MC109166
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Residues in low-complexity regions (%) | 11.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.35 |
| Average transmembrane regions | 2.8 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L0ETR6 | 36-170 | 135 | SDNDSFLRLVEIRDWLSGQDWFDMTQYRLGLKGGTLMHWSRLIDLIIGSFIMFFSLFMPQEQAENITISIYPLLLIIPIMIVMAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O29918-F1 | 49-155 | 76.55 | 97.43 | View in AlphaFoldDB ↗ |