DPCfam | MC10901
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 551 |
|---|---|
| Mean domain length (aa) | 122 ± 20 aa |
| Residues in low-complexity regions (%) | 0.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16077 |
| Sequences matching dominant architecture (%) | 98.44 |
| Average overlap percent | 77.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P5PSY5 | 436-564 | 129 | DGITSSEERRYSYNHYYGSRRQGEDNHAHRDFAEEGGFLCPSEVKYARPQLAQTSRGVWKYIINMPEHTQTIRMERCLKPSSGCS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B7TB45-F1 | 480-597 | 79.07 | 81.27 | View in AlphaFoldDB ↗ |