DPCfam | MC108943
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 238 ± 22 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.27 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF06054 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 43.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B7GLL3 | 170-396 | 227 | QLSSFSWLFFNDQEVIPFYCAERREISFLHHLIPLSSTLAYGEWATFPLHAISFSSFFQAPQRQHDALFHAWQMKKKQWRLSPLY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31604-F1 | 117-370 | 99.61 | 94.31 | View in AlphaFoldDB ↗ |