DPCfam | MC108497
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Residues in low-complexity regions (%) | 3.32 |
| Residues in coiled-coil regions (%) | 22.82 |
| Predicted disordered residues (%) | 32.73 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05186 |
| Sequences matching dominant architecture (%) | 1.16 |
| Average overlap percent | 62.82 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A8I439 | 3-83 | 81 | ESQKETFRKYLEQAGAIDVLVKVLVQLYEEPSKPKTALDYIKQCLGSPTPAEYEAVVAERDGLQKQLEEANQLIAELQSRV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KDW1-F1 | 10-88 | 96.34 | 90.33 | View in AlphaFoldDB ↗ |