DPCfam | MC108472
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Residues in low-complexity regions (%) | 6.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01612 |
| Sequences matching dominant architecture (%) | 98.04 |
| Average overlap percent | 31.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K4IKY5 | 10-75 | 66 | LSEPAQGVPSVIDDMAGYRRACRMLSRGSGALAADAERASGFRYGHDDYLVQFKRQGSGIFLLDPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EVK7-F1 | 15-80 | 95.65 | 96.85 | View in AlphaFoldDB ↗ |