DPCfam | MC107913
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 377 ± 55 aa |
| Residues in low-complexity regions (%) | 8.44 |
| Residues in coiled-coil regions (%) | 23.62 |
| Predicted disordered residues (%) | 53.7 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00536 |
| Sequences matching dominant architecture (%) | 47.27 |
| Average overlap percent | 12.51 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F1P1W1 | 210-540 | 331 | QELRHLKIKVEELENERNQYEWKLKATKAEIAQLQEQLALKDAEIERLQCQLSRTSSHSEVAEREEVYKRRLKEKHQEVQRLKIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QB48-F1 | 273-664 | 99.49 | 55.92 | View in AlphaFoldDB ↗ |