DPCfam | MC107345
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 163 ± 22 aa |
| Residues in low-complexity regions (%) | 1.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8H0P4 | 2737-2910 | 174 | RRVAKQLEPRLNSYIETKYKESLTSAGNAQELAATGDVGSAVDMLAAKGQWEKCLAMAEKQDYKLLHKYVAMYATNLIKEGNTEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9JKU3-F1 | 1378-1546 | 99.42 | 84.09 | View in AlphaFoldDB ↗ |