DPCfam | MC107279
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 58 ± 7 aa |
| Residues in low-complexity regions (%) | 4.32 |
| Residues in coiled-coil regions (%) | 8.21 |
| Predicted disordered residues (%) | 8.64 |
| Average transmembrane regions | 0.89 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E1A539 | 840-896 | 57 | LRRIYPFLLAMFILIVGFIFQGRQFRLLYERIRNDKYLVGQKLVNYEHGKRPAKAAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9QDQ9-F1 | 844-902 | 98.33 | 82.60 | View in AlphaFoldDB ↗ |