DPCfam | MC10712
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 103 ± 14 aa |
| Residues in low-complexity regions (%) | 0.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00024 |
| Sequences matching dominant architecture (%) | 4.08 |
| Average overlap percent | 45.11 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8A6X3 | 2123-2227 | 105 | VQKNVSVAERPPQIFDHGCVIDFQADPVDRRPAEFQSGFELTLSTRTAAICAVRCYQDGCTGALYDPEKQTCQLGYGDRHVCNNG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044QW86-F1 | 753-847 | 96.94 | 86.02 | View in AlphaFoldDB ↗ |