DPCfam | MC107096
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 103 ± 14 aa |
| Residues in low-complexity regions (%) | 2.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.69 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12626 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 83.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7WGF8 | 331-431 | 101 | PVQPALHQSIAKVIGRQVQATSIPKRFSGPMKEIWELQMRLPRRQGKRAFVTMSHPRFRAAYDFLLVREESGEIEPGLGQWWTEF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HV72-F1 | 332-430 | 98.02 | 94.82 | View in AlphaFoldDB ↗ |