DPCfam | MC106296
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.16 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02408 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 88.49 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G0M9G6 | 20-133 | 114 | CQGTLVFNPPQNLSSVTWYPSNFSTDSPPVFPDNFTCEYQINVPQGLFVFIELTLNITNFQNESAPIQVIDQLGKIEDVFSARSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-H9G327-F1 | 7-132 | 98.45 | 88.65 | View in AlphaFoldDB ↗ |