DPCfam | MC105979
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 174 ± 18 aa |
| Residues in low-complexity regions (%) | 5.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.16 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08513 |
| Sequences matching dominant architecture (%) | 28.57 |
| Average overlap percent | 14.76 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3MCZ9 | 753-925 | 173 | PQTTKNSESVLSKMWNVVQSNNGIKVLLSLLTVKMPITDADQIRTLACKALVGLSRSSSVRQIISKLPLFSSGHIQQLMKEPVLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W2F2-F1 | 783-942 | 98.18 | 82.64 | View in AlphaFoldDB ↗ |