DPCfam | MC105862
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3441 |
|---|---|
| Mean domain length (aa) | 117 ± 19 aa |
| Residues in low-complexity regions (%) | 1.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04828 |
| Sequences matching dominant architecture (%) | 81.22 |
| Average overlap percent | 72.11 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7YCX3 | 17-121 | 105 | EAMTVHAGGCHCGNIRLRFSTDLDPSQIEVRACQCAFCIKHGSRAVADPLGQLIVSVEDHARLHRYRFGLRTADYLICRDCGVYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WJS5-F1 | 21-101 | 78.95 | 96.87 | View in AlphaFoldDB ↗ |