DPCfam | MC105825
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Residues in low-complexity regions (%) | 3.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13649 |
| Sequences matching dominant architecture (%) | 50.0 |
| Average overlap percent | 13.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F4FC35 | 137-209 | 73 | RLAARAIAAGDTTGWFEELYAGGVRGEVDMPWDRTFPHPLLAEWAEREGVRGAGRRAVVTGCGLGADAEFLTG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EVC4-F1 | 3-76 | 96.10 | 91.17 | View in AlphaFoldDB ↗ |