DPCfam | MC105818
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 170 ± 23 aa |
| Residues in low-complexity regions (%) | 9.58 |
| Residues in coiled-coil regions (%) | 0.79 |
| Predicted disordered residues (%) | 52.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08202 |
| Sequences matching dominant architecture (%) | 96.52 |
| Average overlap percent | 61.85 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3IXS4 | 132-282 | 151 | KRRTTTGHLTKRRSSFVRGRINKPLSALTSAELSVGIPSELPGEERLSRLTKECLEFTLQKLSEEFSDLDGVQQFGVQARDAVAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PU34-F1 | 236-402 | 98.84 | 78.84 | View in AlphaFoldDB ↗ |