DPCfam | MC10570
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 160 ± 11 aa |
| Residues in low-complexity regions (%) | 2.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.1 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF17418 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 84.41 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D5UYW6 | 43-211 | 169 | VVICFYVAAAWLPATPFHLPGQAEYVRSGLAALSPQGWAFFTKSPMEDSFALYKVETKGIAAPVGDFPYSKPGNVFGLDREPRKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O06751-F1 | 15-172 | 98.79 | 88.19 | View in AlphaFoldDB ↗ |