DPCfam | MC105620
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 370 ± 50 aa |
| Residues in low-complexity regions (%) | 1.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.01 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF10596- PF12134 |
| Sequences matching dominant architecture (%) | 90.91 |
| Average overlap percent | 69.16 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3FSY2 | 243-636 | 394 | LAYDKGWRVRTEFKAYQILKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFRGTYFPTWEGLFWERASGFEESMK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4J8E6-F1 | 1438-1830 | 99.75 | 86.28 | View in AlphaFoldDB ↗ |