DPCfam | MC105607
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Residues in low-complexity regions (%) | 19.05 |
| Residues in coiled-coil regions (%) | 30.45 |
| Predicted disordered residues (%) | 44.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A139WJ27 | 183-261 | 79 | TGERLEPLGASDDRKSEIVRNSGCDKCVCLENEKDFLQTSLFTLTTYFAQVQFRLRQVVDAPFEDQEELLKSLEEFAFT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W5C1-F1 | 47-149 | 96.91 | 65.65 | View in AlphaFoldDB ↗ |