DPCfam | MC105530
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 147 ± 38 aa |
| Residues in low-complexity regions (%) | 3.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.95 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF11885 |
| Sequences matching dominant architecture (%) | 97.96 |
| Average overlap percent | 13.5 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C4JTS6 | 69-313 | 245 | RCFCLGVFCALVLFVFALFRVTLMHAFIKPVELKIPGPDLVSKPPQWEGFPFLTRYYGGIRTLVSRTENVPEYPNDNEEEKKGNG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VZK9-F1 | 55-222 | 97.56 | 94.24 | View in AlphaFoldDB ↗ |