DPCfam | MC105439
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Residues in low-complexity regions (%) | 6.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.77 |
| Average transmembrane regions | 0.68 |
| Dominant Pfam architecture(s) | PF00955 |
| Sequences matching dominant architecture (%) | 7.58 |
| Average overlap percent | 5.4 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B6ZC76 | 249-353 | 105 | SIIFPIMVLGTCFVRKALDYIFTQRELKWLDDLMPEATKKAKEDERKKSMNDDDNQEEEDVAFLNEKYCKLIDFKISDDKYSNRI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BTY2-F1 | 879-993 | 99.17 | 55.87 | View in AlphaFoldDB ↗ |