DPCfam | MC105396
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Residues in low-complexity regions (%) | 4.7 |
| Residues in coiled-coil regions (%) | 4.16 |
| Predicted disordered residues (%) | 11.03 |
| Average transmembrane regions | 0.37 |
| Dominant Pfam architecture(s) | PF03924 |
| Sequences matching dominant architecture (%) | 85.47 |
| Average overlap percent | 14.03 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q7TFX0 | 202-317 | 116 | TADWRRKLSITVPMAFTLAVVVALFFQTNRWEQGRIKMEFEQRIGNLTQKLQGDFDGYLDVLRTIQNFFASSPSVSQGSFHSFVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q03101-F1 | 25-122 | 96.12 | 79.89 | View in AlphaFoldDB ↗ |