DPCfam | MC10539
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Residues in low-complexity regions (%) | 2.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04917 |
| Sequences matching dominant architecture (%) | 73.33 |
| Average overlap percent | 39.43 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E9CML4 | 284-351 | 68 | VNNKGIYTGGQLKGGTVRADGRLSVGEFLQLDGTAQPGWGCSPNGLVGRTPEGALLSCQNGQWRAISP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P09747-F1 | 306-366 | 98.39 | 94.16 | View in AlphaFoldDB ↗ |