DPCfam | MC10535
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 131 ± 15 aa |
| Residues in low-complexity regions (%) | 12.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.75 |
| Average transmembrane regions | 1.73 |
| Dominant Pfam architecture(s) | PF01554 |
| Sequences matching dominant architecture (%) | 5.88 |
| Average overlap percent | 11.89 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3C301 | 149-248 | 100 | KLKITGLWIGLLTCIFLQTSFLTVYLSRLNWKKVTEEAQIRVGNASNTNDDQLDLVTEERSVMPNQEQISYRSLFLRRGLALALM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1L1P9-F1 | 451-582 | 97.79 | 69.04 | View in AlphaFoldDB ↗ |