DPCfam | MC105340
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 221 ± 17 aa |
| Residues in low-complexity regions (%) | 2.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18962 |
| Sequences matching dominant architecture (%) | 1.24 |
| Average overlap percent | 0.66 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P0U6F1 | 42-255 | 214 | LIPNHSFEDYSECPSGLHQIDKAVPWIQPTAYENHWQATTDYINTCGHMGDAGELLPFPDGNGLAGCVIEQLYKEYVGTCLESPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8LAR0-F1 | 104-163 | 26.94 | 90.82 | View in AlphaFoldDB ↗ |