DPCfam | MC105338
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 240 ± 39 aa |
| Residues in low-complexity regions (%) | 9.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00533- PF00004 |
| Sequences matching dominant architecture (%) | 90.55 |
| Average overlap percent | 71.1 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P1BSW1 | 311-521 | 211 | GSKAVPQGKPNCLAGLTFVFTGELQSLSREDAQDLARRYGAKVTTGPSSKTSYVVLGEGAGPSKLKAIEKNGLKTLDEDGFLGLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GPZ8-F1 | 299-538 | 100.00 | 79.23 | View in AlphaFoldDB ↗ |