DPCfam | MC105250
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 70 ± 13 aa |
| Residues in low-complexity regions (%) | 6.87 |
| Residues in coiled-coil regions (%) | 2.78 |
| Predicted disordered residues (%) | 2.57 |
| Average transmembrane regions | 1.63 |
| Dominant Pfam architecture(s) | PF00610 |
| Sequences matching dominant architecture (%) | 1.67 |
| Average overlap percent | 1.8 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A091CV32 | 982-1065 | 84 | EEEQYLQTGDPQLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-M9PFK5-F1 | 768-843 | 96.20 | 74.55 | View in AlphaFoldDB ↗ |