DPCfam | MC105167
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Residues in low-complexity regions (%) | 6.6 |
| Residues in coiled-coil regions (%) | 77.62 |
| Predicted disordered residues (%) | 44.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16046 |
| Sequences matching dominant architecture (%) | 96.05 |
| Average overlap percent | 53.75 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R3UIG9 | 156-249 | 94 | SNMDSAYNEHLLTISQLQDDIKILKRKLAQKDAELLAKDRIIAGLKSDLDDCESQKRERAFKSERMAKEEINRLKDTIRNLQREK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZJ65-F1 | 206-294 | 96.74 | 89.86 | View in AlphaFoldDB ↗ |