DPCfam | MC105009
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 156 ± 13 aa |
| Residues in low-complexity regions (%) | 0.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00160 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 37.56 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M4LTK9 | 152-319 | 168 | DPYAGWTALLGGWPTGLRMQTSHTLEYQAWPTHCYGMVGVARGMSPNTGDGSSLYTVIGHAPRQLDRNIALAGRVIEGMEHLSSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8G0J9-F1 | 121-194 | 49.06 | 98.13 | View in AlphaFoldDB ↗ |