DPCfam | MC104867
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Residues in low-complexity regions (%) | 14.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13943 |
| Sequences matching dominant architecture (%) | 98.39 |
| Average overlap percent | 91.45 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009BDEF54 | 14-111 | 98 | PTAASFSVWPPSERTRSSVTQRLAETLSTPSVLSQRYGVMDAEEAKATAAAIEEEAFKLASAFFSASSNEDVAENDGTATLQAYS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9M7N6-F1 | 24-114 | 94.90 | 86.76 | View in AlphaFoldDB ↗ |