DPCfam | MC104847
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 142 ± 18 aa |
| Residues in low-complexity regions (%) | 19.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 71.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9DCB4-3 | 512-674 | 163 | VQSLQPSSQSVQYPAVSFPPQHLLPMSPTQHFPLREELAAQFSQLSMSRQSSGDTPEPPSGTVYPASLLPQTAQPQSYVITSAGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2K4E8-F1 | 473-625 | 98.75 | 36.41 | View in AlphaFoldDB ↗ |