DPCfam | MC1046
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Residues in low-complexity regions (%) | 1.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.69 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00636 |
| Sequences matching dominant architecture (%) | 62.77 |
| Average overlap percent | 7.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A8NX83 | 917-1002 | 86 | GQQNANLIPELCAKCTIPASMFRTSYLIPSILWKLDHLFVVKELNMQFFDNAIDEELLYMATTTVSAEMEHNYERLELLGDAFLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2UNX5-F1 | 877-959 | 96.51 | 90.90 | View in AlphaFoldDB ↗ |