DPCfam | MC104554
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 816 ± 156 aa |
| Residues in low-complexity regions (%) | 8.06 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 30.34 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14826- PF00557- PF08644- PF08512 |
| Sequences matching dominant architecture (%) | 57.42 |
| Average overlap percent | 86.42 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N7L4C5 | 81-1060 | 980 | ALLQIFLLGFLEFPETLMIFTPKTLYVLTGGKKYTMLEAVAKEKTLSKSVKLELLKRNKEDGNKSNFRVLTDAIKASGTKIGVLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q4T5-F1 | 65-967 | 99.89 | 86.08 | View in AlphaFoldDB ↗ |