DPCfam | MC104477
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00821 |
| Sequences matching dominant architecture (%) | 93.33 |
| Average overlap percent | 36.1 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F9CHB4 | 1-65 | 64 | MPNYADLNLSGLDIPQSTFDRLFEVNPDEWKKEIKGIEAFYGQFGDRLPQELTKHLLELKRHFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A3DJE3-F1 | 535-601 | 98.53 | 95.96 | View in AlphaFoldDB ↗ |