DPCfam | MC10443
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Residues in low-complexity regions (%) | 0.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00532 |
| Sequences matching dominant architecture (%) | 67.44 |
| Average overlap percent | 16.9 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A191W857 | 252-334 | 82 | LSHGVYRGLLRGRVEFAPTDKMVEQGRLSIQQAAAFFNQQPYEKKAAPIIESLTPMSLNPQIIADSLSPSEYRPTFSVKEIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32HR6-F1 | 257-333 | 97.47 | 95.71 | View in AlphaFoldDB ↗ |