DPCfam | MC104231
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Residues in low-complexity regions (%) | 0.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09149 |
| Sequences matching dominant architecture (%) | 97.41 |
| Average overlap percent | 92.42 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X0NJX8 | 107-203 | 97 | LDGPSVEGEISPIFDNGMLYKIVTEDGSWYFYNDTEKYEMHVRFRFGSKSELQPGERVEMFVRSNKELEASLVVYPHETLRLISG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DCV8-F1 | 129-239 | 99.05 | 84.17 | View in AlphaFoldDB ↗ |